Back to TABLE


COMPLEX IV - subunit VIc
COMPLEX I
13kDa-A   13kDa-B
15kDa
  18kDa
19kDa
  20kDa
23kDa   24kDa
30kDa
  39kDa
42kDa
  49kDa
51kDa   75kDa
ACP
  B8   B12
B14   B14.5a
B14.5b   B15
B16.6
  B17   B17.2
B18   B22   ASHI
MLRQ   MNLL
PDSW   SGDH

COMPLEX II

FP  
Fe-S
CYTb560
CYTb560 small


COMPLEX III
6.4kDa   7.2kDa
11kDa   14kDa
CYTC1   
CP1   CP2
Fe-S
  UQ-B.QP-C

COMPLEX IV
IV   Va   Vb   VIa
VIb
  VIc   VIIa   VIIc

COMPLEX V
alpha   beta
gamma
  delta
epsilon
   b   d   e
f
  g   OSCP
Cf6
  LBP

Peptide alignment
Identity = 82.5%     Similarity = 91.2%
   1
Dm MANTPATSSA---GPVLRGLHNATIKRNLAVSLGLTAVVTIAYKILVNDPKKAAYADFYSKYDANKSFERMKAAGRFQSC
Dp MTNAPATSAASAAGPVLRGLHNATIKRNLAVSLGLTAIITVAYKVLINDPKKAAYAEFYQKYDAKKSFERMKAAGRFQSC
DNA alignment
Colour code:   UTRs    -   Coding   -   Intron(s)   -   NRG element(s)   -   Unknown
   1
Dm ATTTGTTTTAGGTTCCATCTCTATCTCAGATTCTGAATTT---GCAAATGTGAGTACATAACAAGGTTTTTCTTTAAAAAACACGGTTCAAGGGGTTTTG
TT T TA TT ATC TATCTC T A TTT...GCAAATGTGAGT T C ..TTT TTT AA AAC T AA GGGT T..
Dp GTTCCGTATATATTTTATCGATATCTCCAGTCGAAATTTTTCTGCAAATGTGAGTGTTTTTCTT--TTTAGATTTCAATAACTATTTAAAAAGGGTCT--

101
Dm GAACTTAAAAAAAGTAATTAAATATCATACCAGTTGGCCATATCAACTCCATAAATTTCTGGGGAGAATTCATTAGTTGCTA------TGCGTTTAATGG
........AAAAAG TT AAT T AT A TT C.AT T A C A ATT TGGG A AAT C TGCTA......TGCG AATGG
Dp --------AAAAAGACCTTTAATTTGATTTAAATTCTC-ATTTAATAGCAAGCTATTGGTGGGCATAATGCTGCTAGTGCTACAGCACTGCGCAAAATGG

201
Dm CAGCTGCCTTTGAGCACCTTACGTAACTACCGAGCAATATAATTGATTTTTGTGATTTTCATTCTTTTC-AGCGACATGGCCAACACTCCAGCCACCTCC
CA .......TG G A TTACGTAACT CG CAATA AA T TTTTT T TT T -AG....ATG CCAAC CTCCAGC ACCTCC
Dp CAC-------TGCGAAAATTACGTAACTGACGTCCAATACAAATACTTTTTCTCCTTACAGCCAGTCGAAAG----ATGACCAACGCTCCAGCAACCTCC

301
Dm TCTGCC---------GGACCCGTGCTCCGTGGCCTCCACAATGCCACCATCAAGCGCAACCTGGCCGTTTCCCTGGGCCTGACCGCCGTGGTGACCATCG
C GCC.........GG CC GT CT CGTGGCCTCCACAA GCCAC ATCAAGCG AA CTGGCCGT TCCCT GG CTGACCGCC T T ACC TCG
Dp GCCGCCAGCGCCGCCGGCCCAGTCCTGCGTGGCCTCCACAACGCCACGATCAAGCGTAATCTGGCCGTGTCCCTTGGTCTGACCGCCATCATAACCGTCG

401
Dm CCTACAAAATTCTGGTCAACGATCCCAAGAAGGCCGCCTACGCCGACTTCTACTCGTAAATATAGCTTAACTATGCCACATGAATGTCATCATCTGATCT
CCTACAA T CTG TCAACGATCCCAAGAAGGCCGCCTACGCCGA TTCTAC GT A TA A TAT C T TG C TC AT
Dp CCTACAAGGTGCTGATCAACGATCCCAAGAAGGCCGCCTACGCCGAGTTCTACCAGTGAGTACCAAGATAGTATATCTGCTCTGTGACGTCCGACAATTC

501
Dm GTTTTATCCATTATCCCTGCAGGAAGTACGATGCCAACAAGTCCTTCGAGCGCATGAAGGCCGCCGGTCGTTTCCAGTCCTGCTAGGCTATGTTATCCCA
TTT A .........TGCAG AAGTACGA GCCAA AA TCCTTCGAGCGCATGAAGGC GCCGG CGTTTCCAGTCCTGCTA GC A TA CC
Dp ATTTCAAT---------TGCAGAAAGTACGACGCCAAGAAATCCTTCGAGCGCATGAAGGCTGCCGGCCGTTTCCAGTCCTGCTAAGCGACCCTACGCCC

601
Dm AAA------CACAAGTAGTCTAAGTCAAATGATGTTGTAGAACAAGAGTTGCGCTTCTGTATTGAAAACTAAATAGATTTCAGTCTACGTACGTGCACGA
A......C CA TAGT TAAGTC A .GATGT TA .......GTT CGCTTCTGTATTGAAAACTAAATAGATTTCA T ..CGTA GTGCAC
Dp CTAGGTGTACGCATATAGTATAAGTCGAC-GATGTGTTAC-------GTTACGCTTCTGTATTGAAAACTAAATAGATTTCAATT--CGTATGTGCACCG

701
Dm AGGCGTTTTAATTTAGAGCTATCTTGTATTGCCAGCAAAAGTAAATGTGAAGGCAAATTATGATTAAAT--TCTTTATTATTTACTCG
G GTTTTA T ....................CAAA AAA TGA C A T GA T AA ..T TTTATTATTTACTCG
Dp CGCTGTTTTACTGCC--------------------CAAAGACAAAGCTGATTCCGAGTCGGGACTTAAGCGTTTTTATTATTTACTCG