Back to TABLE


COMPLEX I - 51 kDa subunit
COMPLEX I
13kDa-A   13kDa-B
15kDa
  18kDa
19kDa
  20kDa
23kDa   24kDa
30kDa
  39kDa
42kDa
  49kDa
51kDa   75kDa
ACP
  B8   B12
B14   B14.5a
B14.5b   B15
B16.6
  B17   B17.2
B18   B22   ASHI
MLRQ   MNLL
PDSW   SGDH

COMPLEX II

FP  
Fe-S
CYTb560
CYTb560 small


COMPLEX III
6.4kDa   7.2kDa
11kDa   14kDa
CYTC1   CP1   CP2
Fe-S
  UQ-B.QP-C

COMPLEX IV
IV   Va   Vb   VIa
VIb
  VIc   VIIa   VIIc

COMPLEX V
alpha   beta
gamma
  delta
epsilon
   b   d   e
f
  g   OSCP
Cf6
  LBP

Peptide alignment
Identity = 95.4%     Similarity = 96.6%
   1
Dm MAAIVRFNLLTKPQIVATLPASLHVQRFQSTQAPPPGTPPPQTKTKFGPLADEDRIFTNLYGRHDWRLKGALKRGDWYKTKEIVLKGADWIVNEIKTSGL
Dp MAAIVRYNLLTKPQLVATLPGSLQLQRLQSTQAPPAGTPPPQTKTKFGPLADEDRIFTNLYGRHDWRLKGALKRGDWYKTKEIVLKGPNWIINEIKTSGL

101
Dm RGRGGAGFPSGMKWSFMNKPGDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLIAGRAMGAQAAYIYIRGEFYNEASNMQLAIAEAYQAGLIGKN
Dp RGRGGAGFPSGMKWSFMQKPGDGRPKYLVVNADEGEPGTCKDRDIMRHDPHKLVEGCLIAGAAMGAQAAYIYIRGEFYNEASNMQLAIAEAYQAGLIGKN

201
Dm ACGTGYDFDVFMHRGAGAYICGEETALIESLEGKQGKPRLKPPFPADVGVFGCPTTVTNVETVAVAPTICRRGGVWFASFGRTRNSGTKLFNISGHVNRP
Dp ACGTGYDFDVFMHRGAGAYICGEETALIESLEGKQGKPRLKPPFPADVGVFGCPTTVTNVETVAVAPAICRRGGTWFASFGRTRNSGTKLFNISGHVNNP

301
Dm CTVEEEMSIPLKELIERHCGGVTGGWDNLLGVIPGGSSTPIIPKNVCDDVIMDFDGLIAAQTSLGTAAIIVMDKSTDVIKAIARLISFYKHESCGQCTPC
Dp CTVEEEMSIPLKELIERHCGGVTGGWDNLLGVIPGGSSTPIIPKKVCDDVIMDFDGLIAAQTSLGTAAIIVMDKSTDVIKAIARLISFYKHESCGQCTPC

401
Dm REGIGWMNKIMTRFVKGDAQPAEIDMLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPEIEKRMQLHAKRVSN
Dp REGIGWMNKIMTRFVKGDAQPAEIDMLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPEIEKRMQQHAQQTKRASN
DNA alignment
Colour code:   UTRs    -   Coding   -   Intron(s)   -   NRG element(s)   -   Unknown
   1
Dm AATTATTCGGACCATCTGGCAGCGCTGCGTACAAACGTCACATTTCAGCTGTCAGTCAGTTGTCCCGAAAATGGCTGCAATTGTGCGATTTAATTTGTTA
AT TT GG AT AG G G ACA GTCACATTTCAGCTG CAG .......CCGAAAATGGCTGCAATTGTGCGAT TAATTTGTTA
Dp TATATTTTGGTGGATTACTGAGGGTCGGTCACACCAGTCACATTTCAGCTGGCAGGA-------CCGAAAATGGCTGCAATTGTGCGATATAATTTGTTA

101
Dm ACAAAGCCGCAGATTGGTAAATAAACGCCACCTAACCATA-----------AACCAGTTTTCTAACAGTGTCATTAGCTTGTTTCGTAAGGATCATGCCA
AC AAGCCGCA T GGTAAATA A GC A A C T ...........AA AGT T TAAC GTG CATT GCT C TA T A C
Dp ACCAAGCCGCAATTAGGTAAATAGAGGCGAAGAATTCGTTTAAAAAGTGCTAATTAGTGATTTAACTGTGGCATTCGCTGTCCGCTTACTTGTGAGACTT

201
Dm TTGCCATAAG-CTCCCCATGCCTTAAAAACAAACAATTTCCATGCCATCAAATTATGTAATTTTTGCGCAAAGCAAAACAAAAGTGT---CCAGTGTTCT
T AAG.C C CA GCC AAAACAA CA TT CC TGC A CAA TTATGTAATTTTTGCGCAAAGCAAAACAAAA ...C A GTTCT
Dp GTTAATCAAGTCGCTGCAAGCCAGCAAAACAATCATTTCCCTTGCAACCAACTTATGTAATTTTTGCGCAAAGCAAAACAAAACGCAAAGCAAAGGTTCT

301
Dm GCGCAATTTATTGATCTACTCTGAATGTGTCTTGCAGTTGCGACTTTGCCGGCCAGCCTGCATGTGCAGCGCTTCCAGAGCACCCAGGCCCCACCTCCGG
GCGCAATTTATTGAT T TC .TG TCTTGCAGTTGCGACT TGCC G CAGCCTGCA TGCAGCG T CAGAGCAC CAGGCCCCACC CGG
Dp GCGCAATTTATTGATTTGATCATG-TGCTTCTTGCAGTTGCGACTCTGCCTGGCAGCCTGCAGCTGCAGCGGCTGCAGAGCACACAGGCCCCACCCGCGG

401
Dm GCACTCCTCCGCCACAGACGAAGACCAAATTCGGTCCGCTGGCGGACGAAGATCGCATCTTCACCAACCTCTATGGACGACATGACTGGAGGCTGAAGGG
GCAC CC CC CC CAGACGAAGACCAA TT GGTCC TGGC GACGAAGATCGCATCTTCAC AA T TATGGACG CA GACTGGAGGCTGAAGGG
Dp GCACACCGCCACCTCAGACGAAGACCAAGTTTGGTCCCTTGGCCGACGAAGATCGCATCTTCACAAATTTGTATGGACGCCACGACTGGAGGCTGAAGGG

501
Dm AGCTTTGAAGCGCGGCGACTGGTACAAAACCAAGGAGATTGTGCTGAAGGGGGCAGACTGGATCGTTAACGAGATCAAGACGTCCGGCCTGCGCGGACGT
GC TTGAAGCG GGCGACTGGTACAA ACCAAGGAGATTGT CTGAAGGG C A TGGAT T AA GAGATCAAGAC TC GG CTGCGCGG CG
Dp TGCCTTGAAGCGTGGCGACTGGTACAAGACCAAGGAGATTGTCCTGAAGGGTCCCAATTGGATTATCAATGAGATCAAGACATCGGGTCTGCGCGGTCGC

601
Dm GGAGGAGCTGGCTTCCCCAGCGGTATGAAGTGGTCCTTCATGAACAAGCCCGGAGATGGACGCCCCAAGTACTTGGTGGTGAATGCCGATGAGGGTGAGG
GG GG GCTGGCTTCCCCAG GG ATGAAGTGGTC TTCATG A AAGCC GG GATGGACGCCCCAAGTACTTGGTGGTGAATGCCGATGA GGTGAG
Dp GGTGGCGCTGGCTTCCCCAGTGGCATGAAGTGGTCTTTCATGCAAAAGCCTGGCGATGGACGCCCCAAGTACTTGGTGGTGAATGCCGATGAAGGTGAGC

701
Dm AATTGTCCGTGCGTTCCAAGACCAATATTTGATTTTGGTATTCCTTTGCAGGAGAGCCTGGCACCTGCAAGGATCGCGAGATCATGCGCCACGATCCACA
A TT T CGT CAA A ATTT A TT .T T TTT AGG GAGCCTGG AC TGCAA GATCG GA ATCATGCG CACGATCC CA
Dp ATTTTGAAATCCGTGTCAAAAGACCGATTTAAATTCT-TCTGTATTTTTAGGCGAGCCTGGTACTTGCAAAGATCGTGACATCATGCGTCACGATCCCCA

801
Dm CAAGCTGGTGGAGGGCTGTCTGATTGCCGGACGCGCCATGGGCGCCCAGGCTGCCTACATCTACATTCGTGGCGAGTTCTACAACGAGGCTTCCAACATG
CAAGCTGGTGGAGGGCTG CTGATTGC GG GCCATGGGCGCCCAGGCTGC TACATCTA ATTCG GGCGAGTT TACAACGAGGC TCCAACATG
Dp CAAGCTGGTGGAGGGCTGCCTGATTGCGGGCGCTGCCATGGGCGCCCAGGCTGCATACATCTATATTCGCGGCGAGTTTTACAACGAGGCCTCCAACATG

901
Dm CAACTGGCCATTGCCGAGGCCTACCAGGCTGGTCTGATTGGAAAGAATGCGTGCGGAACAGGCTACGACTTCGACGTCTTCATGCACCGCGGCGCTGGAG
CA CTGGCCAT GCCGAGGCCTACCAGGCTGG CT ATTGG AAGAATGC TGCGG AC GGCTACGA TT GA GTCTTCATGCACCG GGCGCTGG G
Dp CAGCTGGCCATCGCCGAGGCCTACCAGGCTGGCCTTATTGGCAAGAATGCCTGCGGCACTGGCTACGATTTTGATGTCTTCATGCACCGTGGCGCTGGTG

1001
Dm CTTACATTTGCGGCGAGGAGACCGCTCTGATCGAATCGCTGGAAGGAAAGCAGGGAAAGCCACGCTTGAAGCCGCCATTCCCAGCTGATGTGGGTGTGTT
C TACATTTGCGGCGAGGAGACCGCT TGAT GA TCGCT GA GGAAAGCAGGG AAGCC CGCTTGAAGCCGCCATTCCC GCTGATGTGGGTGT TT
Dp CATACATTTGCGGCGAGGAGACCGCTTTGATTGAGTCGCTCGAGGGAAAGCAGGGCAAGCCCCGCTTGAAGCCGCCATTCCCCGCTGATGTGGGTGTCTT

1101
Dm CGGTTGCCCAACCACAGTTACCAATGTGGAGACCGTGGCCGTTGCACCAACCATTTGCCGTCGTGGCGGTGTATGGTTCGCCAGCTTCGGTCGCACCCGT
GGTTGCCC AC AC GT ACCAATGTGGAGAC GTGGCCGT GCACC CCAT TG CGTCG GG GG TGGTT GCCAG TT GG CGCACCCGT
Dp TGGTTGCCCCACAACGGTCACCAATGTGGAGACTGTGGCCGTCGCACCCGCCATCTGTCGTCGCGGTGGCACTTGGTTTGCCAGTTTTGGACGCACCCGT

1201
Dm AACTCGGGCACCAAGCTCTTCAACATTTCGGGACATGTCAACAGGCCCTGCACTGTGGAGGAGGAAATGTCCATCCCACTCAAGGAGTTGATTGAGCGCC
AACTCGGGCAC AAGCTCTTCAACAT TCGGGACA GT AACA CCCTG AC GTGGA GAGGAAATGTCCAT CC CT AAGGAG TGATTGAGCG C
Dp AACTCGGGCACGAAGCTCTTCAACATCTCGGGACACGTGAACAATCCCTGTACCGTGGAAGAGGAAATGTCCATTCCGCTGAAGGAGCTGATTGAGCGTC

1301
Dm ACTGCGGAGGCGTCACTGGTGGATGGGATAATCTGCTAGGCGTCATTCCCGGCGGCTCTTCCACCCCCATCATACCCAAAAATGTCTGCGACGATGTTAT
A TG GGAGGCGT ACTGGTGG TGGGA AATCTG T GGCGTCATTCCCGGCGGCTC TCCAC CCCAT AT CCCAAAAA GT TGCGA GATGT AT
Dp ATTGTGGAGGCGTTACTGGTGGCTGGGACAATCTGTTGGGCGTCATTCCCGGCGGCTCATCCACACCCATTATTCCCAAAAAGGTATGCGATGATGTGAT

1401
Dm CATGGACTTCGATGGCCTAATTGCCGCTCAGACTTCGCTGGGTACTGCGGCTATCATCGTAATGGACAAGTCGACGGATGTGATAAAGGCTATTGCCAGG
ATGGA TT GATGGC T ATTGC GC CA AC TCGCTGGG AC GCGGC ATCAT GT ATGGACAAGTC ACGGATGTGAT AAGGC ATTGCCAG
Dp TATGGATTTTGATGGCTTGATTGCGGCCCAAACATCGCTGGGAACGGCGGCCATCATTGTGATGGACAAGTCCACGGATGTGATCAAGGCGATTGCCAGA

1501
Dm CTAATTTCATTCTATAAGCATGAGAGCTGTGGCCAGTGCACGCCATGCCGAGAGGGAATCGGTTGGATGAACAAAATCATGACTCGGTAAGTCTGC----
CT AT TC TTCTA AAGCA GAGAGCTGTGGCCAGTGCAC CC TGCCG GAGGG AT GG TGGATGAACAA ATCATGACTCGGTAAGT ....
Dp CTCATCTCGTTCTACAAGCACGAGAGCTGTGGCCAGTGCACACCTTGCCGCGAGGGCATTGGCTGGATGAACAAGATCATGACTCGGTAAGTAGATTTTT

1601
Dm -----AATTTACATGTAATTAAAACAAATTTAACTGTCTATCTCCATTCTCGGTGTAGATTTGTTAAGGGTGACGCCCAGCCCGCTGAGATCGATATGCT
.....A TTTA AA A AA A A T TCT TC T TC AG TTTGT AAGGG GA GC CA CCCGCTGAGAT GATATGCT
Dp CGATAATTTTATTCAGAAACAGAATGAGGCATATTTTCTCTCCATGATATCAACACAGCTTTGTCAAGGGCGATGCTCAACCCGCTGAGATTGATATGCT

1701
Dm GTGGGAGATTTCCAAACAAATTGAGGGACACACTATTTGTGCGCTTGGTGATGGTGCCGCCTGGCCAGTCCAGGGCCTCATTCGTCACTTCCGGCCCGAG
GTGGGAGATTTCCAA CAAATTGAGGG CACAC ATTTG GC T GGTGA GGTGCCGCCTGGCC GTCCAGGGCCTCATTCGTCACTTC G CCCGA
Dp GTGGGAGATTTCCAAGCAAATTGAGGGCCACACCATTTGCGCATTGGGTGACGGTGCCGCCTGGCCTGTCCAGGGCCTCATTCGTCACTTCAGACCCGAA

1801
Dm ATCGAGAAACGTATGCAACTGCATGC---------AAAGCGCGTCAGCAATTAAGATACAAAGTTATAGCTAATTTTATTGATTTCATTAACCAGAGCGC
ATCGAGAAACGTATGCAAC CATGC.........AAAGCGCG CAGCAATTAAG TACAA GTTATAGCTAA TTTATTGATTTCAT A CC G G GC
Dp ATCGAGAAACGTATGCAACAACATGCGCAGCAAACAAAGCGCGCCAGCAATTAAGTTACAATGTTATAGCTAAATTTATTGATTTCATAATCCCGCGTGC

1901
Dm GACTTGATGCCTATAAAGTGTATAGTTCTCTAAACGTTTCAATAAGCCT
TT ATGC TATAAA TGTA TTCTCTAAACG T A AA
Dp TCTTTAATGCATATAAAATGTAATATTCTCTAAACGATGTACAAACTTC