Back to TABLE


COMPLEX III - 14 kDa subunit
COMPLEX I
13kDa-A   13kDa-B
15kDa
  18kDa
19kDa
  20kDa
23kDa   24kDa
30kDa
  39kDa
42kDa
  49kDa
51kDa   75kDa
ACP
  B8   B12
B14   B14.5a
B14.5b   B15
B16.6
  B17   B17.2
B18   B22   ASHI
MLRQ   MNLL
PDSW   SGDH

COMPLEX II

FP  
Fe-S
CYTb560
CYTb560 small


COMPLEX III
6.4kDa   7.2kDa
11kDa   14kDa
CYTC1   CP1   CP2
Fe-S
  UQ-B.QP-C

COMPLEX IV
IV   Va   Vb   VIa
VIb
  VIc   VIIa   VIIc

COMPLEX V
alpha   beta
gamma
  delta
epsilon
   b   d   e
f
  g   OSCP
Cf6
  LBP

Peptide alignment
Identity = 88.3%     Similarity = 94.6%
   1
Dm MSNYIARKGPAVLSNLGRWAYNLSGFNQYGLHRDDCLYENEDVKEAVRRLPRKLYDERNYRIMRALHLSMTKTILPKEQWTKYEEDVKYLEPYLKEVVKE
Dp MASYIARKGPSVFSKLGKWAYNMSRFNQYGLHRDDCLYENEDVKEAIRRLPRKIYDERNYRIMRALHLSMTKTILPKEQWTKYEEDVKYLEPYLNEVVKE

101
Dm REEREDWEKIH
Dp REEREDWNKNH
DNA alignment
Colour code:   UTRs    -   Coding   -   Intron(s)   -   NRG element(s)   -   Unknown
   1
Dm CTCATACCTAAAATAAAA-AGGCTGGAGGAATATCTCTTTCCCGACTTCTGAT---TTTACGTAAACCATGTCGAACTATATTGCCAGAAAGGGACCCGC
TCATA CTAAAA AAAA.AGG AGG TTTC GA TT T T...TTT CGT AA ATG CGA CTA ATTGC AG AA GG CC C
Dm GTCATATCTAAAAAAAAATAGGAGCCAGGCGACCGAGTTTCTAGAATTATTTTCAATTTCCGTGAATAATGGCGAGCTACATTGCTAGGAAAGGTCCATC

101
Dm AGTTCTCTGTAAGTAATACGAACG--GGCAACAATCGGACTCACGTTGCATGCAACAAATTTCGTAGTGCAGTACGCCGGAATATTA---TGATTACGTA
GTT TCTGTAAGTA TA G..GGC C A G T C TG AT.......AT CG GT C G C GAAT TTA...TGATTACGTA
Dm GGTTTTCTGTAAGTATTATTTTGGATGGCTGCCACGGCGATGCCCATGAAT-------ATGACGCCGTTCTTGTGGTCTGAATGTTAGAATGATTACGTA

201
Dm AATATGTAATGCGAATTTTTCCCCA-----CAGCAAATCTGGGCAGATGGGCCTACAATCTCTCCGGATTCAACCAATACGGTAGGACTACTAT--ATAA
AATATGTAA A TTTTT .....CAGC AA CTGGGCA ATGGGCCTACAA T TC GATTCAA CA TACGGTA G TA A ..ATA
Dm AATATGTAACTAAATTTTTTTTTGCAATTGCAGCTAAACTGGGCAAATGGGCCTACAACATGTCTAGATTCAATCAGTACGGTAAGTTTAGCACTAATAG

301
Dm CCTAGTGATTCCTAACAGCTGAGCTTGATGCCATCGATTTT-------TGCAGGTCTGCATCGCGATGATTGTCTGTATGAGAACGAGGATGTGAAGGAG
C T G A T AAC G TT C AT GATTT .......TG AGGTCTGCA CG GA GATTGTCT TATGAGAACGAGGATGTGAAGGA
Dm CGTTGGCAATTGCAACGAAAATGTTTCTAACTATGGATTTGCATTGGATGTAGGTCTGCACCGTGACGATTGTCTCTATGAGAACGAGGATGTGAAGGAA

401
Dm GCCGTGCGCCGATTGCCCAGGAAGCTGTACGATGAGCGTAACTACCGCATCATGAGGGCCCTCCATCTGTCCATGACCAAGACCATTCTGCCCAAGGAGC
GC T CGCCG TGCCC G AAG T TACGA GAGCG AACTACCG AT ATG G GC CT CAT TGTCCATGACCAA AC ATT TGCC AA GAGC
Dm GCAATCCGCCGTCTGCCCCGCAAGATTTACGACGAGCGCAACTACCGTATTATGCGTGCTCTGCATTTGTCCATGACCAAAACAATTTTGCCAAAAGAGC

501
Dm AGTGGACCAAGTACGAGGAGGACGTCAAGTATCTGGAACCCTACCTCCAAGGAGGTCGTGAAGGAGCGCGAGGAGCGTGAGGACTGGGAAAAGATCCATA
AGTGGAC AAGTACGAGGAGGA GTCAA TA TGGA CCCTA T AA GAGGT GT AAGGAGCGCGAGGAGCGTGAGGACTGG A AAGA CCACTA
Dm AGTGGACTAAGTACGAGGAGGATGTCAAATACTTGGAGCCCTATTTGAACGAGGTGGTTAAGGAGCGCGAGGAGCGTGAGGACTGGAACAAGAACCACTA

601
Dm AA--------CGCGCCACTAAATCCCTCTACTTTGGACTTGTAAATGTTGAAATACATAGCTTAGATAAATACCAAA
A ........C C C C CCCT C T A TT TAAATGTT AAATACATAGCTTAGAT AA AC AAA
Dm AGAACTTAGCCCCTTCCCCTCCCCCCTAACCACTCAATTTATAAATGTTCAAATACATAGCTTAGATTAAAACTAAA